PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 444702
Common NameRR4-1, SELMODRAFT_444702
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family ARR-B
Protein Properties Length: 471aa    MW: 51017.8 Da    PI: 4.9921
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
444702genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.61.2e-27185238155
  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
              k+r++W+ +LH+ Fv+av+qL G ekA+Pk+ile+m+v+gLt+e+v+SHLQkYRl
   444702 185 KARVVWSGDLHRLFVKAVNQL-GVEKAVPKRILEIMSVQGLTRENVASHLQKYRL 238
              68*******************.********************************8 PP

2Response_reg83.94.9e-28171251109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl+vdD+pl + ll+++l + +y +v++++ + eal+ll+ek+  +Dl++ D+ mp+mdG++ll+ i  e  +lp+i+++++ge + + e +  Ga 
        444702  17 VLVVDDDPLCLLLLKKMLLQCKY-HVTACSRAVEALQLLREKKfqFDLVISDVYMPDMDGFKLLELIGLEM-DLPVIMMSGNGETSVVMEGITHGAC 111
                   89*********************.***************999989**********************6644.8************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   d+l Kp+ +eel++
        444702 112 DYLLKPVRIEELRN 125
                   ************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23001.7E-4214144No hitNo description
SuperFamilySSF521724.84E-3714137IPR011006CheY-like superfamily
SMARTSM004482.4E-3315127IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011043.92316131IPR001789Signal transduction response regulator, receiver domain
PfamPF000724.8E-2517126IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.15E-2518130No hitNo description
PROSITE profilePS512949.855182241IPR017930Myb domain
SuperFamilySSF466891.79E-18183242IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-27184242IPR009057Homeodomain-like
TIGRFAMsTIGR015574.3E-25185238IPR006447Myb domain, plants
PfamPF002498.8E-6187237IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 471 aa     Download sequence    Send to blast
MSDDTTDGEG FPIGMRVLVV DDDPLCLLLL KKMLLQCKYH VTACSRAVEA LQLLREKKFQ  60
FDLVISDVYM PDMDGFKLLE LIGLEMDLPV IMMSGNGETS VVMEGITHGA CDYLLKPVRI  120
EELRNIWQHV VRKRGAKEAA KEESSGEWDD SSEKFPEYTS KKRKDKDADS SGGDDPIEDM  180
SGLKKARVVW SGDLHRLFVK AVNQLGVEKA VPKRILEIMS VQGLTRENVA SHLQKYRLGL  240
KRLSGVDMEP HPIASFQADE SGSFGGSMFV RPAGSSKSSI ARTTSCAGGV FGKGVEQLDP  300
GTLTALKQLQ SSIRGGGGGG SGGAQVLKGP RALKMRQVAF DRNQSGGGGG ALQRTASIEL  360
GNLKMQDEWG SAWSVAPTAN AAAIKEEQRS GGESSFSSSV EEQMDLPDLA SFKAAAPSNQ  420
QPQGLNRITE DSSVELDDFC LPEGSNYFIP PLPPPPFPSL QQQENWSIDF *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-20184244464ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002980853.10.0type B response regulator
TrEMBLD8SC740.0D8SC74_SELML; Type B response regulator
STRINGEFJ180380.0(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP29217120
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31920.12e-66response regulator 10
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]